PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_131.79
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family bZIP
Protein Properties Length: 348aa    MW: 39296.4 Da    PI: 6.4161
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_131.79genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.73.8e-11198243550
                                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                                   kr +r   NR +A+rsR RK+++i eLe+ v +L++e +aL  ++ 
  evm.model.supercontig_131.79 198 KRVKRILANRQSAQRSRVRKLQYISELERSVTTLQTEVSALSPRVA 243
                                   8999*********************************999987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.5E-13194258IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.703196248IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.45E-11198252No hitNo description
Gene3DG3DSA:1.20.5.1708.7E-14198249No hitNo description
PfamPF001708.1E-10198242IPR004827Basic-leucine zipper domain
CDDcd147032.77E-24199249No hitNo description
PROSITE patternPS000360201216IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MAQLPPKVPH NWPNSFPHHQ PTMTSSNFFF PAAAASAAVP ETHQPSWIDE FMDFSSARRG  60
AHRRCISDSI AFLEAPLLAD DEEETRNEST NNNNAANNNN SGNDNAMHGF DRLDDEQLLS  120
MFSDDVSIAV PPATSNPSTP SDQNSNNEEK TVMDYGLAPQ QLKQEPGEVE SPCINKSHEP  180
QPPFQQLSNI GDTIIDPKRV KRILANRQSA QRSRVRKLQY ISELERSVTT LQTEVSALSP  240
RVAFLDHQRL ILNVDNSTLK QRIAALAQDK IFKDAHQEAL KKEIERLRQV YHQQNLKKMN  300
SSQTQPSVHQ HHHHHQQQQQ HQHQQQQQQQ PPSADSMVCT DTEQLLS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015899153.11e-125PREDICTED: basic leucine zipper 61-like
SwissprotQ9M2K42e-95BZP61_ARATH; Basic leucine zipper 61
TrEMBLA0A061F9231e-125A0A061F923_THECC; Basic-leucine zipper transcription factor family protein
STRINGPOPTR_0001s38320.11e-110(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17532777
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.13e-92bZIP family protein